PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI06G10300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 294aa    MW: 31923 Da    PI: 11.1854
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI06G10300.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.11.2e-144085348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +WT+eEd  l ++  + G+++W+++a+ m+ +R++ qc++rw+++l
  ORUFI06G10300.1 40 AWTPEEDAALERLAVENGSRHWRRVAAQMPRKRSPVQCRDRWRDHL 85
                     6*****************************99***********986 PP

2Myb_DNA-binding45.71.5e-14202247146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r +WT+eEd  l ++  + G+++W+++a+ m+ +R++ qc++rw++
  ORUFI06G10300.1 202 RPAWTPEEDAALERLAVENGSRHWRRVAAQMPRKRSPAQCRDRWRT 247
                      789*****************************99**********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.9153389IPR017930Myb domain
SMARTSM007176.2E-123787IPR001005SANT/Myb domain
SuperFamilySSF466891.5E-1939135IPR009057Homeodomain-like
PfamPF002494.6E-144085IPR001005SANT/Myb domain
CDDcd001678.32E-124085No hitNo description
Gene3DG3DSA:1.10.10.602.8E-164097IPR009057Homeodomain-like
SMARTSM007170.01790141IPR001005SANT/Myb domain
CDDcd001671.20E-493138No hitNo description
PROSITE profilePS500907.14393139IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.607.7E-798137IPR009057Homeodomain-like
PROSITE profilePS5129417.602197253IPR017930Myb domain
SMARTSM007176.8E-11201251IPR001005SANT/Myb domain
SuperFamilySSF466892.08E-11201249IPR009057Homeodomain-like
PfamPF002491.3E-13202247IPR001005SANT/Myb domain
CDDcd001672.06E-11204247No hitNo description
Gene3DG3DSA:1.10.10.606.0E-13204248IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MAMMEPSSSS SSSTASAVTP SSAPPSGRCC VVLRIKLPAA WTPEEDAALE RLAVENGSRH  60
WRRVAAQMPR KRSPVQCRDR WRDHLARDVF HRPYTAADDD ELTRLVLRPG GGGDRWKDIS  120
RAVHGRSSRS VKRRWMEIGT SDELLRKLWH PRSSMLSPAT VVDAVPSSSS NAVADDQCAS  180
AVTPSSAPPS GRCCVVLRIR LRPAWTPEED AALERLAVEN GSRHWRRVAA QMPRKRSPAQ  240
CRDRWRTTSP ATCSTAPSPR PTTTSSPASS CAPAAAATDG RTSAGRCTAA ARAP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3osf_A3e-14321381106MYB21
3osf_D3e-14321381106MYB21
3osg_A3e-14321381106MYB21
3osg_D3e-14321381106MYB21
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0055270.0AP005527.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0603C10.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642266.15e-96PREDICTED: transcription factor MYB44-like
TrEMBLA0A0E0PW120.0A0A0E0PW12_ORYRU; Uncharacterized protein
STRINGLOC_Os06g14700.12e-95(Oryza sativa Japonica Group)
STRINGORGLA06G0093600.12e-95(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP83601346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.14e-16myb domain protein r1